Structure of PDB 3hm5 Chain A |
>3hm5A (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] |
QVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQF KKRSVEDLKERYYHICAKLANVRA |
|
PDB | 3hm5 SANT domain of human DNA methyltransferase 1 associated protein 1 |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
R165 D168 |
R32 D35 |
|
|
|
|