Structure of PDB 3hf1 Chain A

Receptor sequence
>3hf1A (length=279) Species: 9606 (Homo sapiens) [Search protein sequence]
SNEEPLLRKSSRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHW
NKLKADEKYFISHILAFFAASDENLVERFSQEVQVPEARCFYGFQILIEN
VHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKST
FGERVVAFAAVEGVFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHC
DFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGLIGMNCILM
KQYIEFVADRLLVELGFSKVFQAENPFDF
3D structure
PDB3hf1 2.6 A X-ray crystal structure of human p53R2, a p53-inducible ribonucleotide reductase .
ChainA
Resolution2.6 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y138 D227
Catalytic site (residue number reindexed from 1) Y106 D195
Enzyme Commision number 1.17.4.1: ribonucleoside-diphosphate reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE A E131 E194 E228 H231 E99 E162 E196 H199
Gene Ontology
Molecular Function
GO:0004748 ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
GO:0005515 protein binding
GO:0016491 oxidoreductase activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0000731 DNA synthesis involved in DNA repair
GO:0001822 kidney development
GO:0003014 renal system process
GO:0006264 mitochondrial DNA replication
GO:0006281 DNA repair
GO:0006979 response to oxidative stress
GO:0009185 ribonucleoside diphosphate metabolic process
GO:0009200 deoxyribonucleoside triphosphate metabolic process
GO:0009263 deoxyribonucleotide biosynthetic process
GO:0009265 2'-deoxyribonucleotide biosynthetic process
GO:0010971 positive regulation of G2/M transition of mitotic cell cycle
GO:0014075 response to amine
GO:0055086 nucleobase-containing small molecule metabolic process
GO:0070318 positive regulation of G0 to G1 transition
GO:1902254 negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005971 ribonucleoside-diphosphate reductase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3hf1, PDBe:3hf1, PDBj:3hf1
PDBsum3hf1
PubMed19728742
UniProtQ7LG56|RIR2B_HUMAN Ribonucleoside-diphosphate reductase subunit M2 B (Gene Name=RRM2B)

[Back to BioLiP]