Structure of PDB 3hdy Chain A

Receptor sequence

>3hdyA (length=365) Species: 1299 (Deinococcus radiodurans)

QESKGFDYLIVGAGFAGSVLAERLASSGQRVLIVDRRPHIGGNAYDCYDD
AGVLIHPYGPHIFHTNSKDVFEYLSRFTEWRPYQHRVLASVDGQLLPIPI
NLDTVNRLYGLNLTSFQVEEFFASVAEKVEQVRTSEDVVVSKVGRDLYNK
FFRGYTRKQWGLDPSELDASVTARVPTRTNRDNRYFADTYQAMPLHGYTR
MFQNMLSSPNIKVMLNTDYREIADFIPFQHMIYTGPVDAFFDFCYGKLPY
RSLEFRHETHDTEQLLPTGTVNYPNDYAYTRVSEFKHITGQRHHQTSVVY
EYPRAEGDPYYPVPRPENAELYKKYEALADAAQDVTFVGRLATYRYYNMD
QVVAQALATFRRLQG

3D structure

• PDB: 3hdy Structural basis of substrate binding to UDP-galactopyranose mutase: crystal structures in the reduced and oxidized state complexed with UDP-galactopyranose and UDP.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R198 R202 R275 R305 E325 Y370 N372
• Catalytic site (residue number reindexed from 1): R174 R178 R251 R281 E301 Y346 N348
• Enzyme Commision number: 5.4.99.9: UDP-galactopyranose mutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDU	A	I86 H109 F175 F176 Y179 T180 W184 V195 T196 R198 Y209 F210 N296 R305 Y335 Y370	I62 H85 F151 F152 Y155 T156 W160 V171 T172 R174 Y185 F186 N272 R281 Y311 Y346	MOAD: Kd=66uM
BS02	FAD	A	V35 G36 G38 A40 D59 R60 R61 G66 N67 P84 H85 I86 D242 Y243 G363 R364 Y371 N372 M373 V376	V11 G12 G14 A16 D35 R36 R37 G42 N43 P60 H61 I62 D218 Y219 G339 R340 Y347 N348 M349 V352

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008767 UDP-galactopyranose mutase activity
• GO:0016853 isomerase activity
• GO:0050660 flavin adenine dinucleotide binding

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3hdy, PDBe:3hdy, PDBj:3hdy
• PDBsum: 3hdy
• PubMed: 19836401
• UniProt: Q9RYF1