Structure of PDB 3hdl Chain A

Receptor sequence

>3hdlA (length=304) Species: 145709 (Roystonea regia)

DLQIGFYNTSCPTAESLVQQAVAAAFANNSGIAPGLIRMHFHDCFVRGCD
ASVLLDSTANNTAEKDAIPNNPSLRGFEVITAAKSAVEAACPQTVSCADI
LAFAARDSANLAGNITYQVPSGRRDGTVSLASEANAQIPSPLFNATQLIN
SFANKTLTADEMVTLSGAHSIGVAHCSSFTNRLYNFNSGSGIDPTLSPSY
AALLRNTCPANSTRFTPITVSLDIITPSVLDNMYYTGVQLTLGLLTSDQA
LVTEANLSAAVKANAMNLTAWASKFAQAMVKMGQIEVLTGTQGEIRTNCS
VVNS

3D structure

• PDB: 3hdl Crystal structure and statistical coupling analysis of highly glycosylated peroxidase from royal palm tree (Roystonea regia).
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R38 H42 N70 H169
• Catalytic site (residue number reindexed from 1): R38 H42 N70 H169
• Enzyme Commision number: 1.11.1.7: peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	P34 R38 F41 R75 S140 P141 F152 L165 A168 H169 G172 V173 A174 H175 S178 L222 L245 S247	P34 R38 F41 R75 S140 P141 F152 L165 A168 H169 G172 V173 A174 H175 S178 L222 L245 S247
BS02	CA	A	S170 D223 T226 V229 D231	S170 D223 T226 V229 D231
BS03	CA	A	D43 V46 G48 D50 S52	D43 V46 G48 D50 S52

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0140825 lactoperoxidase activity

Biological Process

• GO:0006950 response to stress
• GO:0006979 response to oxidative stress
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005576 extracellular region
• GO:0009505 plant-type cell wall
• GO:0009506 plasmodesma

External links

• PDB: RCSB:3hdl, PDBe:3hdl, PDBj:3hdl
• PDBsum: 3hdl
• PubMed: 19854274
• UniProt: D1MPT2