Structure of PDB 3hdh Chain A

Receptor sequence

>3hdhA (length=291) Species: 9823 (Sus scrofa)

KILVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEES
LRKVAKKKFAENPKAGDEFVEKTLSSISTSTDAASVVHSTDLVVEAIVEN
LKVKSELFKRLDKFAAEHTIFASNTSSLQITSLANATTRQDRFAGLHFFN
PVPLMKLVEVVKTPMTSQKTLESLVDFSKTLGKHPVSCKDTPGFIVNRLL
VPYLIEAVRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFI
IDGWHEMDSQNPLFQPSPAMNKLVAENKFGKKTGEGFYKYK

3D structure

• PDB: 3hdh Pig heart short chain L-3-hydroxyacyl-CoA dehydrogenase revisited: sequence analysis and crystal structure determination.
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S137 H158 E170 N208
• Catalytic site (residue number reindexed from 1): S126 H147 E159 N197
• Enzyme Commision number: 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	L25 M26 D45 Q46 A107 I108 E110 K115 N135 S137 H158	L14 M15 D34 Q35 A96 I97 E99 K104 N124 S126 H147

Gene Ontology

Molecular Function

• GO:0003857 3-hydroxyacyl-CoA dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0042802 identical protein binding
• GO:0070403 NAD+ binding

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0006635 fatty acid beta-oxidation
• GO:0007283 spermatogenesis
• GO:0030154 cell differentiation
• GO:0050796 regulation of insulin secretion

Cellular Component

• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix

External links

• PDB: RCSB:3hdh, PDBe:3hdh, PDBj:3hdh
• PDBsum: 3hdh
• PubMed: 10548046
• UniProt: P00348|HCDH_PIG Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial (Gene Name=HADH)