Structure of PDB 3haj Chain A

Receptor sequence
>3hajA (length=286) Species: 9606 (Homo sapiens) [Search protein sequence]
DSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARR
WRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNW
QKEAFHKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKE
EKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKEL
DQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKA
IYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQF
3D structure
PDB3haj Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
ChainA
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA A V71 E72 G74 Q76 Y77 E81 V55 E56 G58 Q60 Y61 E65
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0008092 cytoskeletal protein binding
GO:0008289 lipid binding
GO:0042802 identical protein binding
GO:0045296 cadherin binding
GO:0070300 phosphatidic acid binding
Biological Process
GO:0006897 endocytosis
GO:0007010 cytoskeleton organization
GO:0030036 actin cytoskeleton organization
GO:0030100 regulation of endocytosis
GO:0036010 protein localization to endosome
GO:0045806 negative regulation of endocytosis
GO:0048858 cell projection morphogenesis
GO:0050804 modulation of chemical synaptic transmission
GO:0070836 caveola assembly
GO:0072584 caveolin-mediated endocytosis
GO:0097320 plasma membrane tubulation
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005901 caveola
GO:0005911 cell-cell junction
GO:0005925 focal adhesion
GO:0016607 nuclear speck
GO:0032587 ruffle membrane
GO:0034451 centriolar satellite
GO:0042995 cell projection
GO:0043231 intracellular membrane-bounded organelle
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3haj, PDBe:3haj, PDBj:3haj
PDBsum3haj
PubMed19549836
UniProtQ9UNF0|PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 (Gene Name=PACSIN2)

[Back to BioLiP]