Structure of PDB 3h87 Chain A |
>3h87A (length=136) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
TDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECG EIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLL IAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHR |
|
PDB | 3h87 The crystal structure of the Rv0301-Rv0300 VapBC-3 toxin-antitoxin complex from M. tuberculosis reveals a Mg(2+) ion in the active site and a putative RNA-binding site. |
Chain | A |
Resolution | 1.49 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D99 D117 D119 |
D98 D116 D118 |
|
|
|
|