Structure of PDB 3h7u Chain A

Receptor sequence
>3h7uA (length=312) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
AITFFKLNTGAKFPSVGLGTWQASPGLVGDAVAAAVKIGYRHIDCAQIYG
NEKEIGAVLKKLFEDRVVKREDLFITSKLWCTDHDPQDVPEALNRTLKDL
QLEYVDLYLIHWPARIKKGSVGIKPENLLPVDIPSTWKAMEALYDSGKAR
AIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVHL
SAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSV
LPKSTNEGRIKENFNVFDWSIPDYMFAKFAEIEQARLVTGSFLVHETLSP
YKSIEELWDGEI
3D structure
PDB3h7u Characterization of two novel aldo-keto reductases from Arabidopsis: expression patterns, broad substrate specificity, and an open active-site structure suggest a role in toxicant metabolism following stress.
ChainA
Resolution1.25 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) S27 D47 Y52 K81 H114
Catalytic site (residue number reindexed from 1) S24 D44 Y49 K78 H111
Enzyme Commision number 1.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP A G22 T23 W24 D47 Y52 H114 W115 N159 Q180 Y206 S207 P208 L209 S211 P212 G213 A239 L254 P255 K256 S257 R262 E265 N266 G19 T20 W21 D44 Y49 H111 W112 N156 Q177 Y203 S204 P205 L206 S208 P209 G210 A236 L251 P252 K253 S254 R259 E262 N263 MOAD: Kd=163nM
BS02 ACT A W24 Y52 H114 W21 Y49 H111
Gene Ontology
Molecular Function
GO:0004033 aldo-keto reductase (NADPH) activity
GO:0008106 alcohol dehydrogenase (NADP+) activity
GO:0016229 steroid dehydrogenase activity
GO:0016491 oxidoreductase activity
GO:0070401 NADP+ binding
Biological Process
GO:0009409 response to cold
GO:0009414 response to water deprivation
GO:0009636 response to toxic substance
GO:0009651 response to salt stress
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3h7u, PDBe:3h7u, PDBj:3h7u
PDBsum3h7u
PubMed19616008
UniProtQ0PGJ6|AKRC9_ARATH NADPH-dependent aldo-keto reductase, chloroplastic (Gene Name=AKR4C9)

[Back to BioLiP]