Structure of PDB 3h33 Chain A

Receptor sequence
>3h33A (length=72) Species: 35554 (Geobacter sulfurreducens) [Search protein sequence]
IDKITYPTRIGAVVFPHKKHQDALGECRGCHEKGPGRIDGFDKVMAHGKG
CKGCHEEMKIGPVRCGDCHKGG
3D structure
PDB3h33 Structural characterization of a family of cytochromes c(7) involved in Fe(III) respiration by Geobacter sulfurreducens.
ChainA
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A F15 H17 H20 L24 C27 C30 H31 R37 I38 F15 H17 H20 L24 C27 C30 H31 R37 I38
BS02 HEM A F15 P16 K19 H20 G50 C51 C54 H55 I60 P62 F15 P16 K19 H20 G50 C51 C54 H55 I60 P62
BS03 HEM A T8 R9 I10 D42 K43 A46 H47 H55 V63 C65 C68 H69 T8 R9 I10 D42 K43 A46 H47 H55 V63 C65 C68 H69
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:3h33, PDBe:3h33, PDBj:3h33
PDBsum3h33
PubMed19857457
UniProtQ74G82

[Back to BioLiP]