Structure of PDB 3gsh Chain A

Receptor sequence

>3gshA (length=91) Species: 4513 (Hordeum vulgare)

LNCGQVDSKMKPCLTYVQGGPGPSGECCNGVRDLHNQAQSSGDRQTVCNC
LKGIARGIHNLNLNNAASIPSKCNVNVPYTISPDIDCSRIY

3D structure

• PDB: 3gsh The crystal structure of oxylipin-conjugated barley LTP1 highlights the unique plasticity of the hydrophobic cavity of these plant lipid-binding proteins.
• Chain: A
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	N29 D33	N29 D33
BS02	TFA	A	L34 H35 V47 V77 P78	L34 H35 V47 V77 P78
BS03	ASY	A	D7 M10 G53 I58 I81	D7 M10 G53 I58 I81
BS04	ASY	A	H35 N76	H35 N76

Gene Ontology

Molecular Function

• GO:0008289 lipid binding

Biological Process

• GO:0006869 lipid transport

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3gsh, PDBe:3gsh, PDBj:3gsh
• PDBsum: 3gsh
• PubMed: 19836358
• UniProt: P07597|NLTP1_HORVU Non-specific lipid-transfer protein 1 (Gene Name=LTP1)