Structure of PDB 3grx Chain A

Receptor sequence

>3grxA (length=82) Species: 562 (Escherichia coli) [Search protein sequence]

ANVEIYTKETCPYSHRAKALLSSKGVSFQELPIDGNAAKREEMIKRSGRT
TVPQIFIDAQHIGGYDDLYALDARGGLDPLLK

3D structure

PDB

3grx NMR structure of Escherichia coli glutaredoxin 3-glutathione mixed disulfide complex: implications for the enzymatic mechanism.

Chain

Resolution

N/A

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

Enzymatic activity

Catalytic site (original residue number in PDB)	K8 T10 C11 Y13 S14 K18 Y65
Catalytic site (residue number reindexed from 1)	K8 T10 C11 Y13 S14 K18 Y65
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	C11 T51 V52	C11 T51 V52

Gene Ontology

	Molecular Function
GO:0015035	protein-disulfide reductase activity
GO:0015038	glutathione disulfide oxidoreductase activity
GO:0043295	glutathione binding

	Biological Process
GO:0009263	deoxyribonucleotide biosynthetic process
GO:0034599	cellular response to oxidative stress
GO:0045454	cell redox homeostasis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

External links

PDB	RCSB:3grx, PDBe:3grx, PDBj:3grx
PDBsum	3grx
PubMed	9973569
UniProt	P0AC62\|GLRX3_ECOLI Glutaredoxin 3 (Gene Name=grxC)