Structure of PDB 3gpe Chain A

Receptor sequence

>3gpeA (length=137) Species: 10116 (Rattus norvegicus)

TEKRGRIYLKAEVTDEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPK
NESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDF
MGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPE

3D structure

• PDB: 3gpe Structural and mechanistic insights into the association of PKCalpha-C2 domain to PtdIns(4,5)P2.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.11.13: protein kinase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	M186 D187 D246 D248 D254	M31 D32 D91 D93 D99
BS02	CA	A	D187 D193 D246 W247 D248	D32 D38 D91 W92 D93
BS03	CA	A	D248 T251 R252 D254	D93 T96 R97 D99
BS04	PO4	A	D193 W247 D248 R249	D38 W92 D93 R94
BS05	PT5	A	Y195 K197 K209 K211 N253	Y40 K42 K54 K56 N98	PDBbind-CN: -logKd/Ki=5.74,Kd=1.8uM

External links

• PDB: RCSB:3gpe, PDBe:3gpe, PDBj:3gpe
• PDBsum: 3gpe
• PubMed: 19346474
• UniProt: P05696|KPCA_RAT Protein kinase C alpha type (Gene Name=Prkca)