Structure of PDB 3glz Chain A |
>3glzA (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA LLSPYSYSTTAVVTN |
|
PDB | 3glz Novel transthyretin amyloid fibril formation inhibitors: synthesis, biological evaluation, and X-ray structural analysis |
Chain | A |
Resolution | 1.78 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
1BD |
A |
S117 T119 |
S108 T110 |
|
|
|
|