Structure of PDB 3glw Chain A

Receptor sequence
>3glwA (length=86) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPT
WHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG
3D structure
PDB3glw Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
ChainA
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide A N10 R60 N61 F62 G63 S64 Y65 V66 T67 H68 T70 F73 Y75 Y77 N7 R57 N58 F59 G60 S61 Y62 V63 T64 H65 T67 F70 Y72 Y74
Gene Ontology
Molecular Function
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000132 establishment of mitotic spindle orientation
GO:0007017 microtubule-based process
GO:0007283 spermatogenesis
GO:0007290 spermatid nucleus elongation
GO:0007291 sperm individualization
GO:0007476 imaginal disc-derived wing morphogenesis
GO:0008407 chaeta morphogenesis
GO:0022416 chaeta development
GO:0034454 microtubule anchoring at centrosome
GO:0035220 wing disc development
GO:0045892 negative regulation of DNA-templated transcription
GO:0048477 oogenesis
GO:0051017 actin filament bundle assembly
GO:0141006 piRNA-mediated retrotransposon silencing by heterochromatin formation
GO:1904801 positive regulation of neuron remodeling
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005814 centriole
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0015630 microtubule cytoskeleton
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:0090571 RNA polymerase II transcription repressor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3glw, PDBe:3glw, PDBj:3glw
PDBsum3glw
PubMed19759397
UniProtQ24117|DYL1_DROME Dynein light chain 1, cytoplasmic (Gene Name=ctp)

[Back to BioLiP]