Structure of PDB 3glt Chain A

Receptor sequence

>3gltA (length=274) Species: 9606 (Homo sapiens)

GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQ
YDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKG
LLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRA
DVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGT
SLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGV
ESLVELLGWTEEMRDLVQRETGKL

3D structure

• PDB: 3glt Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P155 D156 F157 R158 N229 D231 H248
• Catalytic site (residue number reindexed from 1): P35 D36 F37 R38 N109 D111 H128
• Enzyme Commision number: 2.3.1.286: protein acetyllysine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	G145 A146 G147 T150 D156 F157 R158 F180 Q228 H248 V292 F294 G295 E296 P297 G319 T320 S321 E323 V324 E325 N344 R345 D365 V366	G25 A26 G27 T30 D36 F37 R38 F60 Q108 H128 V172 F174 G175 E176 P177 G199 T200 S201 E203 V204 E205 N224 R225 D245 V246
BS02	ZN	A	C256 C259 C280 C283	C136 C139 C160 C163

Gene Ontology

Molecular Function

• GO:0017136 NAD-dependent histone deacetylase activity
• GO:0051287 NAD binding
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:3glt, PDBe:3glt, PDBj:3glt
• PDBsum: 3glt
• PubMed: 19535340
• UniProt: Q9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)