Structure of PDB 3gj9 Chain A

Receptor sequence
>3gj9A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]
TAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTR
VSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLV
TRQSLQKA
3D structure
PDB3gj9 Molecular mechanism of inward rectifier potassium channel 2.3 regulation by tax-interacting protein-1
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A I28 L29 G30 F31 S32 I33 Q39 Q43 T58 R59 H90 D91 I19 L20 G21 F22 S23 I24 Q30 Q34 T49 R50 H81 D82
BS02 ZN A H19 E103 H10 E94
BS03 ZN A E62 E67 E53 E58
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008013 beta-catenin binding
Biological Process
GO:0007266 Rho protein signal transduction
GO:0008285 negative regulation of cell population proliferation
GO:0016055 Wnt signaling pathway
GO:0030178 negative regulation of Wnt signaling pathway
GO:0090630 activation of GTPase activity
GO:2000009 negative regulation of protein localization to cell surface
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0015629 actin cytoskeleton
GO:0043231 intracellular membrane-bounded organelle
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3gj9, PDBe:3gj9, PDBj:3gj9
PDBsum3gj9
PubMed19635485
UniProtO14907|TX1B3_HUMAN Tax1-binding protein 3 (Gene Name=TAX1BP3)

[Back to BioLiP]