Structure of PDB 3gfm Chain A |
>3gfmA (length=141) Species: 111955 (Sulfurisphaera tokodaii) [Search protein sequence] |
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAY LANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRAILIEITEKGLETFN KGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ |
|
PDB | 3gfm ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators. |
Chain | A |
Resolution | 2.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
A |
E143 Q146 |
E138 Q141 |
|
|
|
|