Structure of PDB 3g6t Chain A

Receptor sequence
>3g6tA (length=78) Species: 10116 (Rattus norvegicus) [Search protein sequence]
SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIID
KIRRKNCPACRYRKCLQAGMNLEARKTK
3D structure
PDB3g6t DNA binding site sequence directs glucocorticoid receptor structure and activity.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A S459 F463 R466 R490 K491 R497 S23 F27 R30 R54 K55 R61
BS02 dna A C450 H451 Y452 K461 K465 R511 C14 H15 Y16 K25 K29 R75
BS03 ZN A C440 C443 C460 C4 C7 C24
BS04 ZN A C477 C483 C493 C496 C41 C47 C57 C60
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3g6t, PDBe:3g6t, PDBj:3g6t
PDBsum3g6t
PubMed19372434
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]