Structure of PDB 3g53 Chain A

Receptor sequence
>3g53A (length=145) [Search protein sequence]
SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYF
KRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNH
ITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL
3D structure
PDB3g53 Ligand migration and cavities within Scapharca Dimeric HbI: studies by time-resolved crystallo-graphy, Xe binding, and computational analysis.
ChainA
Resolution1.64 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM A Y50 F51 R53 H69 H101 R104 E110 F111 Y49 F50 R52 H68 H100 R103 E109 F110
BS02 CMO A M37 H69 L73 M36 H68 L72
BS03 LT1 A S21 W22 I25 N32 L36 M74 V121 L122 W135 S20 W21 I24 N31 L35 M73 V120 L121 W134
BS04 HEM A K96 N100 K95 N99
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0015671 oxygen transport
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3g53, PDBe:3g53, PDBj:3g53
PDBsum3g53
PubMed19913484
UniProtP02213|GLB1_ANAIN Globin-1

[Back to BioLiP]