Structure of PDB 3g4u Chain A

Receptor sequence
>3g4uA (length=145) [Search protein sequence]
SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYF
KRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNH
ITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL
3D structure
PDB3g4u Ligand migration and cavities within Scapharca Dimeric HbI: studies by time-resolved crystallo-graphy, Xe binding, and computational analysis.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A Y50 F51 R53 H69 N100 H101 R104 F111 I114 Y49 F50 R52 H68 N99 H100 R103 F110 I113
BS02 CMO A M37 F51 H69 L73 M36 F50 H68 L72
BS03 0CL A I25 L122 W135 I24 L121 W134
BS04 HEM A K96 N100 K95 N99
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0001666 response to hypoxia
GO:0015671 oxygen transport
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3g4u, PDBe:3g4u, PDBj:3g4u
PDBsum3g4u
PubMed19913484
UniProtP02213|GLB1_ANAIN Globin-1

[Back to BioLiP]