Structure of PDB 3fym Chain A |
>3fymA (length=82) Species: 158878 (Staphylococcus aureus subsp. aureus Mu50) [Search protein sequence] |
KTVGEALKGRRERLGMTLTELEQRTGIKREMLVHIENNEFDQLPNKNYSE GFIRKYASVVNIEPNQLIQAHQDEIPSNQAEW |
|
PDB | 3fym The 1A structure of YmfM, a putative DNA-binding membrane protein from Staphylococcus aureus |
Chain | A |
Resolution | 1.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E1031 H1035 |
E30 H34 |
|
|
|
|