Structure of PDB 3fsv Chain A |
>3fsvA (length=118) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
CSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLST AADMQGVVTDGMASDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEQY MFFCAAAHAAAMKGTLTL |
|
PDB | 3fsv Metal-binding loop length and not sequence dictates structure. |
Chain | A |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
M64 H116 |
M62 H108 |
|
|
|
|