Structure of PDB 3fsa Chain A |
>3fsaA (length=122) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLEQYMFFCAAHAAMKGTLTLK |
|
PDB | 3fsa Metal-binding loop length and not sequence dictates structure. |
Chain | A |
Resolution | 0.98 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU1 |
A |
H46 C112 H115 |
H46 C109 H112 |
|
|
|
|