Structure of PDB 3fr4 Chain A

Receptor sequence

>3fr4A (length=131) Species: 9606 (Homo sapiens) [Search protein sequence]

CDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVIT
IKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGK
STTIKRKREDDKLVVECVMKGVTSTRVYERA

3D structure

PDB

3fr4 N-Benzyl-indolo carboxylic acids: Design and synthesis of potent and selective adipocyte fatty-acid binding protein (A-FABP) inhibitors.

Chain

Resolution

2.16 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F8A	A	F16 A33 A36 P38 S53 S55 F57 K58 A75 D76 I104 C117 R126 Y128	F16 A33 A36 P38 S53 S55 F57 K58 A75 D76 I104 C117 R126 Y128	MOAD: ic50=0.049uM PDBbind-CN: -logKd/Ki=6.19,IC50=0.65uM

Gene Ontology

	Molecular Function
GO:0005324	long-chain fatty acid transmembrane transporter activity
GO:0005504	fatty acid binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0051427	hormone receptor binding

	Biological Process
GO:0009617	response to bacterium
GO:0015908	fatty acid transport
GO:0015909	long-chain fatty acid transport
GO:0042632	cholesterol homeostasis
GO:0045892	negative regulation of DNA-templated transcription
GO:0050729	positive regulation of inflammatory response
GO:0050872	white fat cell differentiation
GO:0050873	brown fat cell differentiation
GO:0071285	cellular response to lithium ion
GO:0071356	cellular response to tumor necrosis factor
GO:0120162	positive regulation of cold-induced thermogenesis

External links

PDB	RCSB:3fr4, PDBe:3fr4, PDBj:3fr4
PDBsum	3fr4
PubMed	19217286
UniProt	P15090\|FABP4_HUMAN Fatty acid-binding protein, adipocyte (Gene Name=FABP4)