Structure of PDB 3fqo Chain A

Receptor sequence
>3fqoA (length=157) Species: 273036 (Staphylococcus aureus RF122) [Search protein sequence]
TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESI
GKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLYEE
MIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHT
FLHLIRK
3D structure
PDB3fqo Crystal structures of wild-type and mutant methicillin-resistant Staphylococcus aureus dihydrofolate reductase reveal an alternate conformation of NADPH that may be linked to trimethoprim resistance.
ChainA
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 NDP A V6 A7 I14 N18 Q19 L20 G43 R44 K45 T46 L62 T63 S64 F92 G94 Q95 T96 E100 T121 V6 A7 I14 N18 Q19 L20 G43 R44 K45 T46 L62 T63 S64 F92 G94 Q95 T96 E100 T121
BS02 N22 A L5 V6 A7 L20 D27 L28 V31 S49 I50 F92 L5 V6 A7 L20 D27 L28 V31 S49 I50 F92 MOAD: ic50=0.67uM
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Feb 20 10:04:01 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3fqo', asym_id = 'A', title = 'Crystal structures of wild-type and mutant methi...H that may be linked to trimethoprim resistance. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3fqo', asym_id='A', title='Crystal structures of wild-type and mutant methi...H that may be linked to trimethoprim resistance. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004146,0046654,0050661', uniprot = '', pdbid = '3fqo', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004146,0046654,0050661', uniprot='', pdbid='3fqo', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>