Structure of PDB 3fqj Chain A

Receptor sequence

>3fqjA (length=353) Species: 10090 (Mus musculus)

PSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPIN
GPGPDFDLRDGYPDRYQPRDEEVQERLDHLLRWVLEHRNQGWLAGATVTW
RGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLARPPLL
RELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAYCSVLRSRLGNHPLLF
SGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQS
FLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSVCMNFC
AAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPSWYVET
MTQ

3D structure

• PDB: 3fqj Structure and function of the 5'-->3' exoribonuclease Rat1 and its activating partner Rai1.
• Chain: A
• Resolution: 2.623 Å

Enzymatic activity

• Enzyme Commision number: 3.1.13.-
  3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D236 E253 K255	D205 E222 K224
BS02	GDP	A	R58 R95 E101 W131 R132 G133 C217 G233 E234 Q280	R32 R69 E75 W100 R101 G102 C186 G202 E203 Q249

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0004527 exonuclease activity
• GO:0008409 5'-3' exonuclease activity
• GO:0034353 mRNA 5'-diphosphatase activity
• GO:0046872 metal ion binding
• GO:0110152 RNA NAD+-cap (NAD+-forming) hydrolase activity

Biological Process

• GO:0006402 mRNA catabolic process
• GO:0050779 RNA destabilization
• GO:0071028 nuclear mRNA surveillance
• GO:0090304 nucleic acid metabolic process
• GO:0110155 NAD-cap decapping

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:3fqj, PDBe:3fqj, PDBj:3fqj
• PDBsum: 3fqj
• PubMed: 19194460
• UniProt: O70348|DXO_MOUSE Decapping and exoribonuclease protein (Gene Name=Dxo)