Structure of PDB 3fqc Chain A

Receptor sequence

>3fqcA (length=157) Species: 273036 (Staphylococcus aureus RF122)

TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESI
GKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEE
MIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHT
FLHLIRK

3D structure

• PDB: 3fqc Crystal structures of wild-type and mutant methicillin-resistant Staphylococcus aureus dihydrofolate reductase reveal an alternate conformation of NADPH that may be linked to trimethoprim resistance.
• Chain: A
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	V6 A7 I14 N18 G43 R44 K45 T46 L62 T63 S64 H77 F92 G94 Q95 T96 E100 T121	V6 A7 I14 N18 G43 R44 K45 T46 L62 T63 S64 H77 F92 G94 Q95 T96 E100 T121
BS02	55V	A	L5 V6 A7 L20 D27 V31 I50 F92	L5 V6 A7 L20 D27 V31 I50 F92	MOAD: ic50=0.064uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 12:55:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3fqc', asym_id = 'A', title = 'Crystal structures of wild-type and mutant methi...H that may be linked to trimethoprim resistance. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3fqc', asym_id='A', title='Crystal structures of wild-type and mutant methi...H that may be linked to trimethoprim resistance. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004146,0046654,0050661', uniprot = '', pdbid = '3fqc', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004146,0046654,0050661', uniprot='', pdbid='3fqc', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>