Structure of PDB 3fm7 Chain A

Receptor sequence
>3fm7A (length=103) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
QFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKP
YKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFG
LAV
3D structure
PDB3fm7 Multivalency in the assembly of intrinsically disordered Dynein intermediate chain.
ChainA
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A G72 G74 L75 H76 T77 S79 C81 Y82 W83 N85 R94 G64 G66 L67 H68 T69 S71 C73 Y74 W75 N77 R86
BS02 peptide A Y32 N38 K60 Q69 Y24 N30 K52 Q61
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0045505 dynein intermediate chain binding
GO:0051959 dynein light intermediate chain binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0007018 microtubule-based movement
GO:0007286 spermatid development
GO:0008090 retrograde axonal transport
GO:0008340 determination of adult lifespan
Cellular Component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0030286 dynein complex
GO:0032991 protein-containing complex
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3fm7, PDBe:3fm7, PDBj:3fm7
PDBsum3fm7
PubMed19759397
UniProtQ94524|DYLT_DROME Dynein light chain Tctex-type (Gene Name=Dlc90F)

[Back to BioLiP]