Structure of PDB 3fjw Chain A

Receptor sequence

>3fjwA (length=331) Species: 5323 (Pleurotus eryngii) [Search protein sequence]

ATCDDGRTTANAACCILFPILDDIQENLFDGAQCGEEVHESLRLTFHDAI
GFSPTLGGGGADGSIIAFDTIETNFPANAGIDEIVSAQKPFVAKHNISAG
DFIQFAGAVGVSNCPGGVRIPFFLGRPDAVAASPDHLVPEPFDSVDSILA
RMGDAGFSPVEVVWLLASHSIAAADKVDPSIPGTPFDSTPGVFDSQFFIE
TQLKGRLFPGTADNKGEAQSPLQGEIRLQSDHLLARDPQTACEWQSMVNN
QPKIQNRFAATMSKMALLGQDKTKLIDCSDVIPTPPALVGAAHLPAGFSL
SDVEQACAATPFPALTADPGPVTSVPPVPGS

3D structure

PDB

3fjw Structural and Site-directed Mutagenesis Study of Versatile Peroxidase Oxidizing both Mn(II) and Aromatic Substrates

Chain

Resolution

2.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	R43 H47 H169 F186 D231
Catalytic site (residue number reindexed from 1)	R43 H47 H169 F186 D231
Enzyme Commision number	1.11.1.16: versatile peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BMA	A	P295 A296 D318 T323	P295 A296 D318 T323
BS02	MAN	A	S188 P326	S188 P326
BS03	HEM	A	H39 E40 L42 R43 F46 E140 P141 L166 S168 H169 A172 A173 A174 D175 K176 F186 L228	H39 E40 L42 R43 F46 E140 P141 L166 S168 H169 A172 A173 A174 D175 K176 F186 L228
BS04	CA	A	D48 G60 D62 S64	D48 G60 D62 S64
BS05	CA	A	S170 D187 T189 V192 D194	S170 D187 T189 V192 D194
BS06	MN	A	E36 E40 D175	E36 E40 D175
BS07	MAN	A	C242 S246 A309 T310	C242 S246 A309 T310
BS08	MAN	A	Q223 S324 V325 P327	Q223 S324 V325 P327

Gene Ontology

	Molecular Function
GO:0004601	peroxidase activity
GO:0016689	manganese peroxidase activity
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0052750	reactive-black-5:hydrogen-peroxide oxidoreductase activity

	Biological Process
GO:0000302	response to reactive oxygen species
GO:0006979	response to oxidative stress
GO:0034599	cellular response to oxidative stress
GO:0042744	hydrogen peroxide catabolic process
GO:0046274	lignin catabolic process
GO:0098869	cellular oxidant detoxification

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3fjw, PDBe:3fjw, PDBj:3fjw
PDBsum	3fjw
PubMed
UniProt	O94753\|VPL2_PLEER Versatile peroxidase VPL2 (Gene Name=vpl2)

[Back to BioLiP]