Structure of PDB 3fg5 Chain A

Receptor sequence

>3fg5A (length=121) Species: 97228 (Daboia russelii pulchella)

SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCC
YGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNL
NTYSKKYMLYPDFLCKGELKC

3D structure

• PDB: 3fg5 Crystal structure determination of a ternary complex of phospholipase A2 with a pentapeptide FLSYK and Ajmaline at 2.5 A resolution
• Chain: A
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	L2 F5 G6 A18 I19 S23 G30 W31 C45 K69	L2 F5 G6 A17 I18 S22 G29 W30 C44 K60
BS02	AJM	A	D49 Y52	D48 Y51

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 12:57:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3fg5', asym_id = 'A', title = 'Crystal structure determination of a ternary com...ntapeptide FLSYK and Ajmaline at 2.5 A resolution'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3fg5', asym_id='A', title='Crystal structure determination of a ternary com...ntapeptide FLSYK and Ajmaline at 2.5 A resolution')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004623,0005509,0006644,0016042,0050482', uniprot = '', pdbid = '3fg5', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004623,0005509,0006644,0016042,0050482', uniprot='', pdbid='3fg5', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>