Structure of PDB 3fep Chain A

Receptor sequence

>3fepA (length=137) Species: 9606 (Homo sapiens)

PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTF
YIKTSTTVWTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLL
KGEGPKTSWTLELTNDGELIETMTADDVVCTKVYVRE

3D structure

• PDB: 3fep Turn-on" protein fluorescence: in situ formation of cyanine dyes.
• Chain: A
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LMC	A	F15 A32 S37 P39 T56 W59 K132	F15 A32 S37 P39 T56 W59 K132

Gene Ontology

Molecular Function

• GO:0001972 retinoic acid binding
• GO:0005501 retinoid binding
• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0016918 retinal binding
• GO:0019841 retinol binding
• GO:0030332 cyclin binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0007165 signal transduction
• GO:0008544 epidermis development
• GO:0015908 fatty acid transport
• GO:0035115 embryonic forelimb morphogenesis
• GO:0042573 retinoic acid metabolic process
• GO:0048672 positive regulation of collateral sprouting

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3fep, PDBe:3fep, PDBj:3fep
• PDBsum: 3fep
• PubMed: 25534273
• UniProt: P29373|RABP2_HUMAN Cellular retinoic acid-binding protein 2 (Gene Name=CRABP2)