Structure of PDB 3fd6 Chain A

Receptor sequence

>3fd6A (length=342) Species: 9606 (Homo sapiens)

FNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLMPRLGIGMDTC
VIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDN
MLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLNPWIV
LGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLVVTQED
VELAYQEAMMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQ
RNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQ
AARFCAEIKSPEGHQAWIIGIVEKGNRTARIIDKPRIIEVAP

3D structure

• PDB: 3fd6 Crystal structures of catalytic intermediates of human selenophosphate synthetase 1.
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 2.7.9.3: selenide, water dikinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	K32 L38 L42 I66 G67 M68 D69 D110	K26 L32 L36 I45 G46 M47 D48 D89
BS02	PO4	A	K32 D87 T267 G268	K26 D66 T235 G236
BS03	MG	A	D69 D110 D265	D48 D89 D233
BS04	ADP	A	M124 L126 G161 G162 Q163 T164	M103 L105 G140 G141 Q142 T143

Gene Ontology

Molecular Function

• GO:0004756 selenide, water dikinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0005525 GTP binding
• GO:0016301 kinase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0016260 selenocysteine biosynthetic process
• GO:0016310 phosphorylation
• GO:0036211 protein modification process

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0031965 nuclear membrane

External links

• PDB: RCSB:3fd6, PDBe:3fd6, PDBj:3fd6
• PDBsum: 3fd6
• PubMed: 19477186
• UniProt: P49903|SPS1_HUMAN Selenide, water dikinase 1 (Gene Name=SEPHS1)