Structure of PDB 3fc8 Chain A

Receptor sequence

>3fc8A (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 3fc8 Iodine atoms: a new molecular feature for the design of potent transthyretin fibrillogenesis inhibitors.
• Chain: A
• Resolution: 1.85 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IFA	A	K15 S52 A108 L110	K6 S43 A99 L101	MOAD: ic50=4.1uM PDBbind-CN: -logKd/Ki=5.39,IC50=4.1uM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3fc8, PDBe:3fc8, PDBj:3fc8
• PDBsum: 3fc8
• PubMed: 19125186
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)