Structure of PDB 3fc3 Chain A

Receptor sequence

>3fc3A (length=189) Species: 85963 (Helicobacter pylori J99) [Search protein sequence]

MLKNDDFVIAKNQLGNIVPNSVGVIRAVNGKSAMVLFIGLNELKRVDFSE
LEAIDIYRTGKGYDKKICNICHILKNTDGFEINQTDAKGRKTTRPSCREC
RKNIDGVKLSSTEKKKMDEIAPPKGSVFTCPICEKRSIVGVTANLVHDHN
HDTGWGREWICDSCNTGLGRFKDNPKFLEKVIEYLKKYE

3D structure

PDB

3fc3 Crystal structure of the beta beta alpha-Me type II restriction endonuclease Hpy99I with target DNA.

Chain

Resolution

1.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	I82 N83 Q84 K91 T166	I82 N83 Q84 K91 T166
BS02	dna	A	K61 N83 Q84 A87 R94 P95 R101 V146 H147 H149 N165 T166 G169 R170	K61 N83 Q84 A87 R94 P95 R101 V146 H147 H149 N165 T166 G169 R170
BS03	ZN	A	C68 C71 C97 C100	C68 C71 C97 C100
BS04	ZN	A	C130 C133 C161 C164	C130 C133 C161 C164
BS05	NA	A	D148 H149 N165	D148 H149 N165

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3fc3, PDBe:3fc3, PDBj:3fc3
PDBsum	3fc3
PubMed	19380375
UniProt	Q9ZL26

[Back to BioLiP]