Structure of PDB 3f9z Chain A

Receptor sequence

>3f9zA (length=156) Species: 9606 (Homo sapiens)

KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFV
VEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRL
INHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEA
HPWLKH

3D structure

• PDB: 3f9z Structural origins for the product specificity of SET domain protein methyltransferases.
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	F245 E259 Y262 A263 G269 C270 M272 Y273 Y274 T307 Y334 Y336 G337 D338 R339 S343 H347 W349	F53 E67 Y70 A71 G73 C74 M76 Y77 Y78 T111 Y138 Y140 G141 D142 R143 S147 H151 W153
BS02	SAH	A	K226 R228 C270 Y271 L296 N298 H299 Y336 W349	K34 R36 C74 Y75 L100 N102 H103 Y140 W153

Gene Ontology

Molecular Function

• GO:0042799 histone H4K20 methyltransferase activity

External links

• PDB: RCSB:3f9z, PDBe:3f9z, PDBj:3f9z
• PDBsum: 3f9z
• PubMed: 19088188
• UniProt: Q9NQR1|KMT5A_HUMAN N-lysine methyltransferase KMT5A (Gene Name=KMT5A)