Structure of PDB 3f3r Chain A

Receptor sequence

>3f3rA (length=106) Species: 4932 (Saccharomyces cerevisiae)

HHHMVTQFKTASEFDSAIAQDKLVVVDFYATWCGPSKMIAPMIEKFSEQY
PQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQ
AIAANA

3D structure

• PDB: 3f3r Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C30 G31 P32 S33
• Catalytic site (residue number reindexed from 1): C33 G34 P35 S36

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GSH	A	W29 C30 P32 M72	W32 C33 P35 M75

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0015035 protein-disulfide reductase activity
• GO:0015036 disulfide oxidoreductase activity

Biological Process

• GO:0000011 vacuole inheritance
• GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
• GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
• GO:0009263 deoxyribonucleotide biosynthetic process
• GO:0015031 protein transport
• GO:0042144 vacuole fusion, non-autophagic
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0000139 Golgi membrane
• GO:0000324 fungal-type vacuole
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space
• GO:0005794 Golgi apparatus
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0120124 membrane fusion priming complex

External links

• PDB: RCSB:3f3r, PDBe:3f3r, PDBj:3f3r
• PDBsum: 3f3r
• PubMed: 19362171
• UniProt: P22217|TRX1_YEAST Thioredoxin-1 (Gene Name=TRX1)