Structure of PDB 3exy Chain A

Receptor sequence
>3exyA (length=81) Species: 1049 (Allochromatium vinosum) [Search protein sequence]
ALMITDECINCDGCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCV
EVCPVDCIIKDPSHEETEDELRAKYERITGE
3D structure
PDB3exy Insight into the protein and solvent contributions to the reduction potentials of [4Fe-4S]2+/+ clusters: crystal structures of the Allochromatium vinosum ferredoxin variants C57A and V13G and the homologous Escherichia coli ferredoxin.
ChainA
Resolution1.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 A I4 C8 I9 C11 C14 Y30 C53 P54 C57 I58 I4 C8 I9 C11 C14 Y30 C53 P54 C57 I58
BS02 SF4 A C18 I23 I32 C37 T38 E39 C40 C49 C18 I23 I32 C37 T38 E39 C40 C49
Gene Ontology
Molecular Function
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding

View graph for
Molecular Function
External links
PDB RCSB:3exy, PDBe:3exy, PDBj:3exy
PDBsum3exy
PubMed19290553
UniProtP00208|FER_ALLVD Ferredoxin (Gene Name=fdx)

[Back to BioLiP]