Structure of PDB 3eu1 Chain A

Receptor sequence

>3eu1A (length=141) Species: 9925 (Capra hircus)

VLSAADKSNVKAAWGKVGGNAGAYGAEALERMFLSFPTTKTYFPHFDLSH
GSAQVKGHGEKVAAALTKAVGHLDDLPGTLSDLSDLHAHKLRVDPVNFKL
LSHSLLVTLACHLPNDFTPAVHASLDKFLANVSTVLTSKYR

3D structure

• PDB: 3eu1 Purification, crystallization and preliminary X-ray diffraction studies on goat (Capra hircus) hemoglobin - a low oxygen affinity species
• Chain: A
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	M32 Y42 F43 H45 H58 K61 L83 H87 L91 N97 F98 L101 L136	M32 Y42 F43 H45 H58 K61 L83 H87 L91 N97 F98 L101 L136

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:3eu1, PDBe:3eu1, PDBj:3eu1
• PDBsum: 3eu1
• PubMed: 19356147
• UniProt: P0CH25|HBA1_CAPHI Hemoglobin subunit alpha-1 (Gene Name=HBA1)