Structure of PDB 3elv Chain A

Receptor sequence
>3elvA (length=145) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
KHVEPQDAISPDNYMDMLGLEARDRTMYELVIYRKNDKDKGPWKRYDLNG
RSCYLVGRELGHTEIVVADIGIPEETSSKQHCVIQFRNVRGILKCYVMDL
DSSNGTCLNNVVIPGARYIELRSGDVLTLSEFEEDNDYELIFMNV
3D structure
PDB3elv Crystal structure of the Pml1p subunit of the yeast precursor mRNA retention and splicing complex.
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SO4 A R108 S137 K138 R58 S78 K79
BS02 SO4 A E179 R181 E120 R122
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0008380 RNA splicing
GO:0051237 maintenance of RNA location
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0005737 cytoplasm
GO:0070274 RES complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3elv, PDBe:3elv, PDBj:3elv
PDBsum3elv
PubMed19010333
UniProtQ07930|PML1_YEAST Pre-mRNA leakage protein 1 (Gene Name=PML1)

[Back to BioLiP]