Structure of PDB 3eku Chain A

Receptor sequence

>3ekuA (length=362) Species: 7227 (Drosophila melanogaster)

EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRKDSYVGDEAQSKRG
ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK
ANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTV
PIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTEEREIVRDIK
EKLCYVALDFEQEMATAASSSSLEKSYELKDGQVITIGNERFRCPEALFQ
PSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRM
QKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYD
ESGPSIVHRKCF

3D structure

• PDB: 3eku Crystal structures of monomeric actin bound to cytochalasin D.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	G13 S14 G15 M16 K18 G156 D157 G158 V159 G182 K213 E214 G302 M305 Y306 K336	G10 S11 G12 M13 K15 G143 D144 G145 V146 G169 K200 E201 G289 M292 Y293 K323
BS02	CA	A	Q263 S265	Q250 S252
BS03	CY9	A	A135 I136 V139 Y143 G168 Y169 A170 P172 M355 F375	A122 I123 V126 Y130 G155 Y156 A157 P159 M342 F362

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0000281 mitotic cytokinesis
• GO:0006338 chromatin remodeling
• GO:0007291 sperm individualization
• GO:0030723 ovarian fusome organization
• GO:0032507 maintenance of protein location in cell
• GO:0035148 tube formation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0031011 Ino80 complex
• GO:0035060 brahma complex

External links

• PDB: RCSB:3eku, PDBe:3eku, PDBj:3eku
• PDBsum: 3eku
• PubMed: 18938176
• UniProt: P10987|ACT1_DROME Actin-5C (Gene Name=Act5C)