Structure of PDB 3eks Chain A

Receptor sequence

>3eksA (length=374) Species: 7227 (Drosophila melanogaster)

DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD
SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH
PVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGI
VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFT
TTEEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELKDGQVITIG
NERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST
FQQMWISKQEYDESGPSIVHRKCF

3D structure

• PDB: 3eks Crystal structures of monomeric actin bound to cytochalasin D.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	G13 S14 G15 K18 G156 D157 G158 V159 G182 K213 E214 G302 M305 Y306	G12 S13 G14 K17 G155 D156 G157 V158 G181 K212 E213 G301 M304 Y305
BS02	CA	A	Q263 S265	Q262 S264
BS03	CY9	A	Y133 A135 I136 Y143 Y169 A170 P172 M355 F375	Y132 A134 I135 Y142 Y168 A169 P171 M354 F374	PDBbind-CN: -logKd/Ki=5.70,Kd=2uM

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0000281 mitotic cytokinesis
• GO:0006338 chromatin remodeling
• GO:0007291 sperm individualization
• GO:0030723 ovarian fusome organization
• GO:0032507 maintenance of protein location in cell
• GO:0035148 tube formation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0031011 Ino80 complex
• GO:0035060 brahma complex

External links

• PDB: RCSB:3eks, PDBe:3eks, PDBj:3eks
• PDBsum: 3eks
• PubMed: 18938176
• UniProt: P10987|ACT1_DROME Actin-5C (Gene Name=Act5C)