Structure of PDB 3ef2 Chain A

Receptor sequence

>3ef2A (length=292) Species: 181124 (Marasmius oreades) [Search protein sequence]

SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAE
PIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWT
IKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKW
YFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDS
GLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNK
AGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY

3D structure

PDB

3ef2 Structural Characterization of a Lectin from the Mushroom Marasmius oreades in Complex with the Blood Group B Trisaccharide and Calcium.

Chain

Resolution

1.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GAL	A	D20 K22 D23 W35 H45	D19 K21 D22 W34 H44
BS02	GLA	A	W35 Q36 T38 N43	W34 Q35 T37 N42
BS03	GAL	A	D72 W87 N95 H97	D71 W86 N94 H96
BS04	GLA	A	W87 Q88 N95	W86 Q87 N94
BS05	GLA	A	D123 V125 N126 W138 N146 H148	D122 V124 N125 W137 N145 H147
BS06	GLA	A	W138 T139 E144 N146	W137 T138 E143 N145
BS07	CA	A	Q211 D214 D216 D217	Q210 D213 D215 D216
BS08	CA	A	D214 D216	D213 D215
BS09	CA	A	L182 D183	L181 D182
BS10	CA	A	G14 V15 P16	G13 V14 P15

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3ef2, PDBe:3ef2, PDBj:3ef2
PDBsum	3ef2
PubMed	19426740
UniProt	Q8X123

[Back to BioLiP]