Structure of PDB 3eeo Chain A

Receptor sequence

>3eeoA (length=327) Species: 735 (Haemophilus parahaemolyticus)

MIEIKDKQLTGLRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYE
MNFGEKPEGDITQVNEKTIPDHDILCAGFPCQAFSISGKQKGFEDSRGTL
FFDIARIVREKKPKVVFMENVKNFASHDNGNTLEVVKNTMNELDYSFHAK
VLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTFVKDLLLPDS
EVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAIT
LSAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYK
QFGNSVVINVLQYIAYNIGSSLNFKPY

3D structure

• PDB: 3eeo M. HhaI co-crystallized with synthetic dsDNA containing a propane diol in place of the deoxycytidine residue targeted for methylation.
• Chain: A
• Resolution: 1.94 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C81 E119 R163 R165
• Catalytic site (residue number reindexed from 1): C81 E119 R163 R165
• Enzyme Commision number: 2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	I86 Q90 G236 Q237 G256 G257 I258 S296 Q297	I86 Q90 G236 Q237 G256 G257 I258 S296 Q297
BS02	dna	A	S85 S87 G88 K89 R97 K162 R165 R228 Q237 R240 Y242 T250 S252 A253 Y254 G255 G256	S85 S87 G88 K89 R97 K162 R165 R228 Q237 R240 Y242 T250 S252 A253 Y254 G255 G256
BS03	SAM	A	F18 G23 E40 W41 G78 N304 S305 V306	F18 G23 E40 W41 G78 N304 S305 V306

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003886 DNA (cytosine-5-)-methyltransferase activity
• GO:0008168 methyltransferase activity

Biological Process

• GO:0009307 DNA restriction-modification system
• GO:0032259 methylation

External links

• PDB: RCSB:3eeo, PDBe:3eeo, PDBj:3eeo
• PDBsum: 3eeo
• UniProt: P05102|MTH1_HAEPH Type II methyltransferase M.HhaI (Gene Name=hhaIM)