Structure of PDB 3eb4 Chain A

Receptor sequence

>3eb4A (length=327) Species: 10116 (Rattus norvegicus)

MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLF
DTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRK
HIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMY
WGTSRWSSMEIMEAYSVARQFNLIPPRCEQAEYHMFQREKVEVQLPELFH
KIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRR
QQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENI
GAIQVLPKLSSSIVHEIDSILGNKPYS

3D structure

• PDB: 3eb4 Cortisone dissociates the Shaker family K+ channels from their beta subunits.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	A	G55 W57 Q63 D85 K118 S188 Q214 W243 S244 P245 L246 A247 C248 G249 K254 R264 L321 L322 G323 S325 Q329 E332 N333	G21 W23 Q29 D51 K84 S154 Q180 W209 S210 P211 L212 A213 C214 G215 K220 R230 L287 L288 G289 S291 Q295 E298 N299
BS02	PDN	A	W57 V89 Y90 W121 N158	W23 V55 Y56 W87 N124

Gene Ontology

Molecular Function

• GO:0005249 voltage-gated potassium channel activity

Biological Process

• GO:0006813 potassium ion transport
• GO:0055085 transmembrane transport

Cellular Component

• GO:0005737 cytoplasm
• GO:0016020 membrane

External links

• PDB: RCSB:3eb4, PDBe:3eb4, PDBj:3eb4
• PDBsum: 3eb4
• PubMed: 18806782
• UniProt: P62483|KCAB2_RAT Voltage-gated potassium channel subunit beta-2 (Gene Name=Kcnab2)