Structure of PDB 3e85 Chain A

Receptor sequence

>3e85A (length=154) Species: 3873 (Lupinus luteus)

GVFTFQDEYTSTIAPAKLYKALVTDADIIIPKAVETIQSVEIVEGNGGPG
TIKKLTFIEGGESKYVLHKIEAIDEANLGYNYSIVGGVGLPDTIEKISFE
TKLVEGANGGSIGKVTIKIETKGDAQPNEEEGKAAKARGDAFFKAIESYL
SAHP

3D structure

• PDB: 3e85 Cytokinin-induced structural adaptability of a Lupinus luteus PR-10 protein.
• Chain: A
• Resolution: 1.95 Å

Enzymatic activity

• Enzyme Commision number: 3.1.27.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BSU	A	L22 V23 L55 H68 Y80 F142	L22 V23 L55 H68 Y80 F142	MOAD: Kd=4.2uM PDBbind-CN: -logKd/Ki=5.38,Kd=4.2uM
BS02	BSU	A	I37 F57 R138	I37 F57 R138	MOAD: Kd=4.2uM PDBbind-CN: -logKd/Ki=5.38,Kd=4.2uM
BS03	BSU	A	Y9 F99 V115 F143	Y9 F99 V115 F143	MOAD: Kd=4.2uM PDBbind-CN: -logKd/Ki=5.38,Kd=4.2uM
BS04	BSU	A	F5 G89 G132 A135 R138	F5 G89 G132 A135 R138	MOAD: Kd=4.2uM PDBbind-CN: -logKd/Ki=5.38,Kd=4.2uM

Gene Ontology

Molecular Function

• GO:0004518 nuclease activity
• GO:0004540 RNA nuclease activity
• GO:0004864 protein phosphatase inhibitor activity
• GO:0005509 calcium ion binding
• GO:0010427 abscisic acid binding
• GO:0038023 signaling receptor activity
• GO:0044373 cytokinin binding
• GO:0046872 metal ion binding
• GO:1904408 melatonin binding

Biological Process

• GO:0006952 defense response
• GO:0009738 abscisic acid-activated signaling pathway

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3e85, PDBe:3e85, PDBj:3e85
• PDBsum: 3e85
• PubMed: 19220853
• UniProt: Q9LLQ2|P102B_LUPLU Class 10 plant pathogenesis-related protein 2B (Gene Name=PR10.2B)