Structure of PDB 3e44 Chain A

Receptor sequence

>3e44A (length=247) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRAAGEPFEKLVYKFLKENLSDLTFKQYEYL
NDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQN
DTADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKE
FDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQF
HVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYI

3D structure

• PDB: 3e44 DNA distortion and specificity in a sequence-specific endonuclease.
• Chain: A
• Resolution: 2.52 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	F138 Y199 A203 A204 R241	F128 Y189 A193 A194 R231
BS02	dna	A	G92 K93 Q109	G82 K83 Q99
BS03	dna	A	Q109 N110 D111 S144 K147 A205 Q207	Q99 N100 D101 S134 K137 A195 Q197
BS04	dna	A	A32 A33 E38 D114 K129 T130 A137 F138 P140 N141	A22 A23 E28 D104 K119 T120 A127 F128 P130 N131
BS05	MN	A	E38 D114 V128	E28 D104 V118
BS06	MN	A	T112 A113 D114 D127	T102 A103 D104 D117

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:3e44, PDBe:3e44, PDBj:3e44
• PDBsum: 3e44
• PubMed: 18762194
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)