Structure of PDB 3e40 Chain A

Receptor sequence

>3e40A (length=247) Species: 727 (Haemophilus influenzae)

SFIKPIYQDINSILIGQKVKRAGEPFEKLVYKFLKENLSDLTFKQYEYLN
DLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQND
TADILLVKDQFYELLDVKTRNISKSAFAPNIISAYKLAQTCAKMIDNKEF
DLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQFH
VRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYIL

3D structure

• PDB: 3e40 DNA distortion and specificity in a sequence-specific endonuclease.
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G92 K93 K108 Q109 F138 Y199 N201 A203 A204 R241	G81 K82 K97 Q98 F127 Y188 N190 A192 A193 R230
BS02	dna	A	Q109 N110 D111 K129 T130 R131 S136 A137 F138 A139 P140 N141 S144 K147 A205 Q207	Q98 N99 D100 K118 T119 R120 S125 A126 F127 A128 P129 N130 S133 K136 A194 Q196
BS03	CA	A	D114 D127 V128	D103 D116 V117

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:3e40, PDBe:3e40, PDBj:3e40
• PDBsum: 3e40
• PubMed: 18762194
• UniProt: P17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)