Structure of PDB 3e2c Chain A

Receptor sequence

>3e2cA (length=158) Species: 83333 (Escherichia coli K-12)

MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESID
EMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKN
LREAIGYADSVHDYVSRDMMIEILRDERGHIDWLRTELDLIQKMGLQNYL
QAQIREEG

3D structure

• PDB: 3e2c Structural and Mechanistic Studies of a Stabilized Subunit Dimer Variant of Escherichia coli Bacterioferritin Identify Residues Required for Core Formation.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	E18 E51 H54 E127	E18 E51 H54 E127
BS02	HEM	A	F26 I49 M52	F26 I49 M52
BS03	HEM	A	I22 N23 I49 M52 A55	I22 N23 I49 M52 A55
BS04	EDO	A	N17 E18 Y58 G97 E127	N17 E18 Y58 G97 E127
BS05	EDO	A	E47 D50 E51 E94 E127 H130	E47 D50 E51 E94 E127 H130

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008199 ferric iron binding
• GO:0015093 ferrous iron transmembrane transporter activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding
• GO:0140315 iron ion sequestering activity

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion
• GO:0034755 iron ion transmembrane transport

Cellular Component

• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:3e2c, PDBe:3e2c, PDBj:3e2c
• PDBsum: 3e2c
• PubMed: 19439409
• UniProt: P0ABD3|BFR_ECOLI Bacterioferritin (Gene Name=bfr)