Structure of PDB 3e1z Chain A |
>3e1zA (length=109) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] |
SHKVTKAHNGATLTVAVGELVEIQLPSNPTTGFAWYFEGGTKESPNESMF TVENKYFPPDSKLLGAGGTEHFHVTVKAAGTHAVNLTYMRPWTGPSHDSE RFTVYLKAN |
|
PDB | 3e1z Crystal structure of the parasite inhibitor chagasin in complex with papain allows identification of structural requirements for broad reactivity and specificity determinants for target proteases. |
Chain | A |
Resolution | 1.86 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E23 H72 H74 |
E22 H71 H73 |
|
|
|
|