Structure of PDB 3dtu Chain A

Receptor sequence

>3dtuA (length=539) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

RRGFFTRWFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQF
MCAEHLESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVI
PALFGGFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGG
NGQLGSGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTF
LNMRAPGMTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTT
FFQPSGGGDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFG
YLPMVYAMVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIK
IFSWIATMWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHD
TYYVVAHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFV
GANLTFFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFL
GVIFYTLTRGARVTANNYWNEHADTLEWTLTSPPPEHTF

3D structure

PDB

3dtu A conserved steroid binding site in cytochrome C oxidase.

Chain

Resolution

2.15 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	Y33 I43 F47 M51 I99 H102 N121 D132 N139 S142 Y146 W172 S200 S201 G204 T211 H284 E286 Y288 S299 P315 H333 H334 T359 K362 H419 F420 H421 R481
Catalytic site (residue number reindexed from 1)	Y21 I31 F35 M39 I87 H90 N109 D120 N127 S130 Y134 W160 S188 S189 G192 T199 H272 E274 Y276 S287 P303 H321 H322 T347 K350 H407 F408 H409 R469
Enzyme Commision number	7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	DMU	A	S83 A84 N87	S71 A72 N75
BS02	DMU	A	W20 M443	W8 M431
BS03	DMU	A	M56 Q61 S83	M44 Q49 S71
BS04	CU	A	H284 H333 H334	H272 H321 H322
BS05	MG	A	H411 D412	H399 D400
BS06	CA	A	E54 A57 G59 Q61	E42 A45 G47 Q49
BS07	HEA	A	G38 T48 M51 R52 W95 I99 H102 G103 M106 M107 W172 Y414 F420 H421 M424 S425 V429 I432 M460 F468 R481 R482 S504 F508	G26 T36 M39 R40 W83 I87 H90 G91 M94 M95 W160 Y402 F408 H409 M412 S413 V417 I420 M448 F456 R469 R470 S492 F496
BS08	HEA	A	W280 V287 Y288 H333 H334 I355 G360 G395 G398 I399 L401 S402 D407 H411 V416 H419 F420 V423 M424 R481	W268 V275 Y276 H321 H322 I343 G348 G383 G386 I387 L389 S390 D395 H399 V404 H407 F408 V411 M412 R469

Gene Ontology

	Molecular Function
GO:0004129	cytochrome-c oxidase activity
GO:0005515	protein binding
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0006119	oxidative phosphorylation
GO:0009060	aerobic respiration
GO:0015990	electron transport coupled proton transport
GO:0022904	respiratory electron transport chain
GO:1902600	proton transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0045277	respiratory chain complex IV

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3dtu, PDBe:3dtu, PDBj:3dtu
PDBsum	3dtu
PubMed	18759498
UniProt	P33517\|COX1_CERSP Cytochrome c oxidase subunit 1 (Gene Name=ctaD)

[Back to BioLiP]